Search results for "plasma confinement"

showing 5 items of 5 documents

Plasma diagnostic tools for ECR ion sources : What can we learn from these experiments for the next generation sources

2019

International audience; The order-of-magnitude performance leaps of ECR ion sources over the past decades result from improvements to the magnetic plasma confinement, increases in the microwave heating frequency, and techniques to stabilize the plasma at high densities. Parallel to the technical development of the ion sources themselves, significant effort has been directed into the development of their plasma diagnostic tools. We review the recent results of Electron Cyclotron Resonance Ion Source (ECRIS) plasma diagnostics highlighting a number of selected examples of plasma density, electron energy distribution, and ion confinement time measurements, obtained mostly with the second-gener…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Solenoidmagnetic fieldshiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesbremsstrahlungElectron cyclotron resonance010305 fluids & plasmasIonoptical emission spectroscopySuperposition principleion sourcesPhysics::Plasma Physics0103 physical sciencesInstrumentation010302 applied physicsPhysics[PHYS]Physics [physics]plasma confinementplasma properties and parametersplasma diagnosticssyklotronitplasma heatingPlasmaIon sourceComputational physicsMagnetic fieldPlasma diagnostics
researchProduct

Experimental evidence on microwave induced electron losses from ECRIS plasma

2018

The balance between warm and hot (>1 keV) electron density and their losses from the magnetic confinement system of an Electron Cyclotron Resonance Ion Source (ECRIS) plasma is considered to be one of the main factors determining the rate of the high charge state ion production. One of the key loss channels for heated electrons is thought to be induced by the injected microwaves. While this loss mechanism, referred to as rf-induced pitch angle scattering, has been studied theoretically and with computational tools, direct experimental evidence of its significance in minimum-B ECRIS plasmas remains limited. In this work, experimental evidence of microwave induced electron losses in the axial…

magnetic mirrorsElectron densityelectrorheological fluidsAtmospheric-pressure plasma7. Clean energy01 natural scienceselectromagnetic radiationElectron cyclotron resonance010305 fluids & plasmassähkömagneettinen säteilyMagnetic mirrormikroaallotion sources0103 physical sciencesplasma (kaasut)010302 applied physicsPhysicsplasma confinementta114Magnetic confinement fusionPlasmaCondensed Matter Physicselectronic structureIon sourcePlasma diagnosticsAtomic physicsPhysics of Plasmas
researchProduct

Influence of axial mirror ratios on the kinetic instability threshold in electron cyclotron resonance ion source plasma

2022

International audience; Electron Cyclotron Resonance (ECR) ion source plasmas are prone to kinetic instabilities. The onset of the instabilities manifests as emission of microwaves, bursts of electrons expelled from the plasma volume, and the collapse of the extracted highly charged ion (HCI) currents. Consequently, the instabilities limit the HCI performance of ECR ion sources by limiting the parameter space available for ion source optimization. Previous studies have shown that the transition from stable to unstable plasma regime is strongly influenced by the magnetic field structure, especially the minimum field value inside the magnetic trap (Bmin). This work focuses to study the role o…

magnetic mirrorsplasma confinementsyklotronit[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]plasma heatingplasma instabilitieshiukkaskiihdyttimetelectron energy distribution functionsplasmafysiikkaCondensed Matter Physicsion sourcesPhysics::Plasma Physicscyclotron resonanceions and propertiesplasma (kaasut)
researchProduct

Quasi-periodical kinetic instabilities in minimum-B confined plasma

2022

We present the results of an experimental investigation of quasi-periodical kinetic instabilities exhibited by magnetically confined electron cyclotron resonance heated plasmas. The instabilities were detected by measuring plasma microwave emission, electron losses, and wall bremsstrahlung. The instabilities were found to be grouped into fast sequences of periodic plasma losses, separated by ∼100 µs between the bursts, followed by 1–10 ms quiescent periods before the next event. Increasing the plasma energy content by adjusting the plasma heating parameters, in particular the magnetic field strength, makes the instabilities more chaotic in the time domain. Statistical analysis reveals that …

plasma confinemention sourcessyklotronitPhysicsQC1-999ECR-ionilähteetGeneral Physics and Astronomyplasma heatingplasma instabilitiescyclotron resonancehiukkaskiihdyttimetplasmafysiikkaAIP Advances
researchProduct

ECRIS plasma spectroscopy with a high resolution spectrometer

2020

Electron Cyclotron Resonance Ion Source (ECRIS) plasmas contain high-energy electrons and highly charged ions implying that only noninvasive methods such as optical emission spectroscopy are reliable in their characterization. A high-resolution spectrometer (10 pm FWHM at 632 nm) enabling the detection of weak emission lines has been developed at University of Jyväskylä, Department of Physics (JYFL) for this purpose. Diagnostics results probing the densities of ions, neutral atoms, and the temperature of the cold electron population in the JYFL 14 GHz ECRIS are described. For example, it has been observed that the cold electron temperature drops from 40 eV to 20 eV when the extraction volta…

Materials scienceIon beamspektroskopiaelectron impact ionizationphotomultipliers01 natural sciences7. Clean energyElectron cyclotron resonance010305 fluids & plasmasIonion sourcesPhysics::Plasma Physics0103 physical sciencesEmission spectrumInstrumentation010302 applied physicsplasma confinementamplitude modulationPlasmaIon sourceemission spectroscopymonochromatorsdoppler effectElectron temperatureAtomic physicsDoppler broadeningplasma spectroscopy
researchProduct